PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04131.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 572aa    MW: 63963.9 Da    PI: 6.8406
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04131.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.1e-152572148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+ Ede l+ +v++ G g+W+++ +  g+ R++k+c++rw ++l
  Rsa1.0_04131.1_g00003.1 25 KGPWTAAEDETLAAYVRENGEGNWNAVQKNTGLARCGKSCRLRWANHL 72
                             79******************************************9986 PP

2Myb_DNA-binding48.12.7e-1578121146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g++T eE+ l++++++qlG++ W++ a+ ++ gRt++++k++w++
  Rsa1.0_04131.1_g00003.1  78 KGSFTGEEERLIIQLHAQLGNK-WARMAAQLP-GRTDNEIKNYWNT 121
                              799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9052072IPR017930Myb domain
SuperFamilySSF466892.07E-2823119IPR009057Homeodomain-like
SMARTSM007174.9E-122474IPR001005SANT/Myb domain
PfamPF002493.6E-142572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-212679IPR009057Homeodomain-like
CDDcd001671.04E-92772No hitNo description
PROSITE profilePS5129424.9173127IPR017930Myb domain
SMARTSM007171.4E-1577125IPR001005SANT/Myb domain
PfamPF002495.7E-1478121IPR001005SANT/Myb domain
CDDcd001672.72E-1180123No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2480125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009860Biological Processpollen tube growth
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MYGGGAEKEG GLANHMSNGG VTLKKGPWTA AEDETLAAYV RENGEGNWNA VQKNTGLARC  60
GKSCRLRWAN HLRPNLRKGS FTGEEERLII QLHAQLGNKW ARMAAQLPGR TDNEIKNYWN  120
TRLKRLQRQG LPIYPPDIIP NHQLHPHPHH HHYQQQNHHH QQHQHQQMYF QQQSSQPNTP  180
SSSPLPSPTP LHANPSSSFT FHTTNASTAY LLHPLSPHTP TTPQTPSQLS STPPPPPLSS  240
PLSSPRNNQY PTLPLFTFPS SQINSNTNFT FPRPPPLLQP PSSLLARRYN NSNTPLNCIN  300
HVSTAPFSPV SRDSYSSFLT LPYSSPTAQT ANYHNTNNSY SSFSLNPSPS SYPATTSSPS  360
FLHSHYTPNY SSTSFHNNPV YSMKQELSSN QIPQISVFNN VNNFTDNEKQ NNTNLHRSIS  420
CSLLEDVLEE AEALASGDGD RPSKRRQLTA SPPNHHDNNN NDNDNFFSVS FEQYDSSENI  480
CSLQDLKPKE EESLQMNTMQ DDIAKLLDWR SDSVEISNGQ SSVVTDDNLV LDVHQLNSLF  540
PADSTATETR TNDEQNNNNN INCSWDNLHG IS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-29231252103C-Myb DNA-Binding Domain
1msf_C3e-29231252103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120026.10.0PREDICTED: transcription factor MYB104-like
TrEMBLM4CFF60.0M4CFF6_BRARP; Uncharacterized protein
STRINGBra002938.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99391934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55020.17e-84myb domain protein 120